>YCL037C SRO9 SGDID:S000000542, Chr III from 58678-57374, reverse
           complement, Verified ORF, "Cytoplasmic RNA-binding
           protein that associates with translating ribosomes;
           involved in heme regulation of Hap1p as a component of
           the HMC complex, also involved in the organization of
           actin filaments; contains a La motif"
          Length = 434

 Score = 30.0 bits (66), Expect = 4e-05
 Identities = 19/70 (27%), Positives = 34/70 (48%), Gaps = 2/70 (2%)

Query: 6   ASDSSNKKKENVKFSKFVTSLSFMKKNTEHHENAKKKIKYSNDNHMWIVNEYEEAAKAYL 65
           ++ +SNK K N   +   +S +  +K   H  NAKK+ +   D     V   EE +K   
Sbjct: 102 SNGNSNKSKNNKTAASSTSSSNANRKKKHHQHNAKKQQQMKKDGFESAVG--EEDSKDAT 159

Query: 66  KKESPQKSKK 75
            +E+ Q +++
Sbjct: 160 SQENGQSTQQ 169

Lambda     K      H
   0.307    0.122    0.330 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 159
Number of extensions: 7
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 119
Length of database: 434
Length adjustment: 22
Effective length of query: 97
Effective length of database: 412
Effective search space:    39964
Effective search space used:    39964
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 20 (11.9 bits)
S2: 20 (12.3 bits)