Query= PF14_0411 Pf
Annotation|Plasmodium_falciparum_TIGR|(protein coding) small nuclear
ribonuclear protein, putative
(101 letters)
>YER146W LSM5 SGDID:S000000948, Chr V from 462580-462861, Verified
ORF, "Lsm (Like Sm) protein; part of heteroheptameric
complexes (Lsm2p-7p and either Lsm1p or 8p):
cytoplasmic Lsm1p complex involved in mRNA decay;
nuclear Lsm8p complex part of U6 snRNP and possibly
involved in processing tRNA, snoRNA, and rRNA"
Length = 93
Score = 51.6 bits (122), Expect = 2e-12
Identities = 21/45 (46%), Positives = 34/45 (75%)
Query: 11 LPLALMDKCIGSKIWIMMKGDKEIVGKLVGFDEYVNMVLEDVTEY 55
LPL ++DK I K+ I+++ ++E G LVGFD++VN++LED E+
Sbjct: 7 LPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEW 51
Lambda K H
0.317 0.137 0.400
Gapped
Lambda K H
0.267 0.0410 0.140
Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 29
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 101
Length of database: 93
Length adjustment: 10
Effective length of query: 91
Effective length of database: 83
Effective search space: 7553
Effective search space used: 7553
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 13 ( 5.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 13 ( 8.8 bits)
S2: 13 ( 9.6 bits)