Query= PF14_0411 Pf Annotation|Plasmodium_falciparum_TIGR|(protein coding) small nuclear ribonuclear protein, putative (101 letters)
>YER146W LSM5 SGDID:S000000948, Chr V from 462580-462861, Verified
          ORF, "Lsm (Like Sm) protein; part of heteroheptameric
          complexes (Lsm2p-7p and either Lsm1p or 8p):
          cytoplasmic Lsm1p complex involved in mRNA decay;
          nuclear Lsm8p complex part of U6 snRNP and possibly
          involved in processing tRNA, snoRNA, and rRNA"
          Length = 93

 Score = 51.6 bits (122), Expect = 2e-12
 Identities = 21/45 (46%), Positives = 34/45 (75%)

Query: 11 LPLALMDKCIGSKIWIMMKGDKEIVGKLVGFDEYVNMVLEDVTEY 55
          LPL ++DK I  K+ I+++ ++E  G LVGFD++VN++LED  E+
Sbjct: 7  LPLEVIDKTINQKVLIVLQSNREFEGTLVGFDDFVNVILEDAVEW 51
Lambda     K      H
   0.317    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 29
Number of extensions: 2
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 101
Length of database: 93
Length adjustment: 10
Effective length of query: 91
Effective length of database: 83
Effective search space:     7553
Effective search space used:     7553
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 13 ( 5.9 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 13 ( 8.8 bits)
S2: 13 ( 9.6 bits)