Query= PFB0450w Pf Annotation|Plasmodium_falciparum_TIGR|(protein coding) Sec61-gamma subunit of protein translocation complex, putative (81 letters)
>YDR086C SSS1 SGDID:S000002493, Chr IV from 617166-616924, reverse
          complement, Verified ORF, "Subunit of the Sec61p
          translocation complex (Sec61p-Sss1p-Sbh1p) that forms a
          channel for passage of secretory proteins through the
          endoplasmic reticulum membrane, and of the Ssh1p
          complex (Ssh1p-Sbh2p-Sss1p); interacts with Ost4p and
          Wbp1p"
          Length = 80

 Score = 59.7 bits (143), Expect = 6e-15
 Identities = 29/66 (43%), Positives = 38/66 (57%)

Query: 13 NHPVGYCVNGIQTFVEDSVRLIRKCTKPNKKEYTNIVYACSFGFLIMGFIGYIIKLVFIP 72
          N+ V   V     FV +  + + KC KP+ KEYT IV A   GF+ +G IGY IKL+ IP
Sbjct: 15 NNQVEKLVEAPVEFVREGTQFLAKCKKPDLKEYTKIVKAVGIGFIAVGIIGYAIKLIHIP 74

Query: 73 INNIFV 78
          I  + V
Sbjct: 75 IRYVIV 80
Lambda     K      H
   0.328    0.147    0.459 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 31
Number of extensions: 1
Number of successful extensions: 1
Number of sequences better than 10.0: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 81
Length of database: 80
Length adjustment: 8
Effective length of query: 73
Effective length of database: 72
Effective search space:     5256
Effective search space used:     5256
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 12 ( 5.7 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 12 ( 8.4 bits)
S2: 12 ( 9.2 bits)