>YDR382W RPP2B SGDID:S000002790, Chr IV from 1239483-1239815,
          Verified ORF, "Ribosomal protein P2 beta, a component
          of the ribosomal stalk, which is involved in the
          interaction between translational elongation factors
          and the ribosome; regulates the accumulation of P1
          (Rpp1Ap and Rpp1Bp) in the cytoplasm"
          Length = 110

 Score = 59.7 bits (143), Expect = 1e-14
 Identities = 30/69 (43%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 3  MKYVAAYLMCVLGGNENPSTKEVKNVLGAVNADVEDEVLNNFIDSLKGK-SCHELITDGL 61
          MKY+AAYL+ V GGN  PS  ++K V+ +V A+V++  +N  + SL+GK S  E+I +G 
Sbjct: 1  MKYLAAYLLLVQGGNAAPSAADIKAVVESVGAEVDEARINELLSSLEGKGSLEEIIAEGQ 60

Query: 62 KKLQNIGGG 70
          KK   +  G
Sbjct: 61 KKFATVPTG 69

Lambda     K      H
   0.316    0.138    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 34
Number of extensions: 4
Number of successful extensions: 2
Number of sequences better than 10.0: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 112
Length of database: 110
Length adjustment: 12
Effective length of query: 100
Effective length of database: 98
Effective search space:     9800
Effective search space used:     9800
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 14 ( 6.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 14 ( 9.2 bits)
S2: 14 (10.0 bits)