>YJR063W RPA12 SGDID:S000003824, Chr X from 555110-555487, Verified
           ORF, "RNA polymerase I subunit A12.2; contains two zinc
           binding domains, and the N terminal domain is
           responsible for anchoring to the RNA pol I complex"
          Length = 125

 Score = 52.0 bits (123), Expect = 7e-12
 Identities = 26/58 (44%), Positives = 35/58 (60%), Gaps = 1/58 (1%)

Query: 263 TSLFKEEEKTAYNITYEKCLDCGNDFLHFINIQTRSADEGSTIIYFCPNCKKQTTVNN 320
           TSL K E K    I  EKC  CGN+ +++  +Q RSADEG+T+ Y C +C  +   NN
Sbjct: 69  TSLKKNELKDGATIK-EKCPQCGNEEMNYHTLQLRSADEGATVFYTCTSCGYKFRTNN 125

 Score = 18.1 bits (35), Expect = 0.11
 Identities = 5/6 (83%), Positives = 6/6 (100%)

Query: 281 CLDCGN 286
           CLDCG+
Sbjct: 10  CLDCGD 15

 Score = 14.6 bits (26), Expect = 1.2
 Identities = 4/7 (57%), Positives = 5/7 (71%)

Query: 208 KCIYCGS 214
           KC  CG+
Sbjct: 85  KCPQCGN 91

Lambda     K      H
   0.316    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 132
Number of extensions: 5
Number of successful extensions: 4
Number of sequences better than 10.0: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 320
Length of database: 125
Length adjustment: 20
Effective length of query: 300
Effective length of database: 105
Effective search space:    31500
Effective search space used:    31500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 19 (11.6 bits)
S2: 19 (11.9 bits)