Query= PFE0660c Pf Annotation|Plasmodium_falciparum_Sanger|(protein coding) uridine phosphorylase, putative (245 letters)
>YDL229W SSB1 SGDID:S000002388, Chr IV from 44066-45907, Verified
           ORF, "Cytoplasmic ATPase that is a ribosome-associated
           molecular chaperone; may be involved in the folding of
           newly-synthesized polypeptide chains; member of the heat
           shock protein 70 (HSP70) family; interacts with the
           phosphatase subunit Reg1p"
          Length = 613

 Score = 28.1 bits (61), Expect = 4e-04
 Identities = 15/40 (37%), Positives = 24/40 (60%), Gaps = 1/40 (2%)

Query: 1   MDNLLRHLKISKEQITPVVLVVGDPGRVDKIKVVCDSYVD 40
           ++ +L+  KISK QI  VVL VG   R+ K++ +   + D
Sbjct: 320 VEQVLKDAKISKSQIDEVVL-VGGSTRIPKVQKLLSDFFD 358

 Score = 18.5 bits (36), Expect = 0.34
 Identities = 6/9 (66%), Positives = 7/9 (77%)

Query: 216 DFDNNLVPH 224
           DFD NL+ H
Sbjct: 235 DFDTNLLEH 243

 Score = 15.0 bits (27), Expect = 3.8
 Identities = 5/7 (71%), Positives = 5/7 (71%)

Query: 3   NLLRHLK 9
           NLL H K
Sbjct: 239 NLLEHFK 245
Lambda     K      H
   0.322    0.140    0.426 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 255
Number of extensions: 12
Number of successful extensions: 3
Number of sequences better than 10.0: 1
Number of HSP's gapped: 3
Number of HSP's successfully gapped: 3
Length of query: 245
Length of database: 613
Length adjustment: 30
Effective length of query: 215
Effective length of database: 583
Effective search space:   125345
Effective search space used:   125345
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 24 (14.0 bits)
S2: 24 (13.9 bits)